PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_89683g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 418aa    MW: 44919.9 Da    PI: 7.3282
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_89683g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-171964147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd  l ++v+++G+++W+ I+r ++ gR++k+c++rw + 
    MA_89683g0010 19 KGPWSPEEDATLHRLVEKYGPRNWSQISRGIP-GRSGKSCRLRWCNQ 64
                     79******************************.***********985 PP

2Myb_DNA-binding54.52.7e-1773115347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++ Ed  +++a++++G++ W+tIar ++ gRt++ +k++w++ 
    MA_89683g0010  73 PFSPHEDATIIQAHARHGNK-WATIARLLP-GRTDNAIKNHWNST 115
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.8551469IPR017930Myb domain
SuperFamilySSF466898.99E-3217112IPR009057Homeodomain-like
SMARTSM007176.9E-171867IPR001005SANT/Myb domain
PfamPF002493.1E-171964IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-252072IPR009057Homeodomain-like
CDDcd001671.16E-152163No hitNo description
SMARTSM007171.2E-1470118IPR001005SANT/Myb domain
PROSITE profilePS5129419.8271120IPR017930Myb domain
PfamPF002491.9E-1473115IPR001005SANT/Myb domain
CDDcd001671.11E-1173116No hitNo description
Gene3DG3DSA:1.10.10.602.6E-2373119IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MGVPKDEAAV TMAVAERIKG PWSPEEDATL HRLVEKYGPR NWSQISRGIP GRSGKSCRLR  60
WCNQLSPQVE HRPFSPHEDA TIIQAHARHG NKWATIARLL PGRTDNAIKN HWNSTLRRRY  120
HGEKDHSNGL VVNLESAAED KEAMISLTAT APAMVPALVF AAAADSSRKR SNSSCSANDN  180
PGDAEVESRR LKRLNFSESP TSSDNNNNNN EEDTNSGHCN SVAPGSSPVQ QLHRPVPRQS  240
AFNCYEAVKM HEEASASVSA SGSAGAFDPP TSLSLSLPGS GSSSENNSSG ECSPIEQSFE  300
TKSAKFQAYQ QQTGYSFADP FPVGGYLKTE EAMAMMSTAV KIAIGQALPL IFQLPSGNSH  360
GGCSGDSSNF GGSLLSIMRE MIAKEVQNYT NGSQCSNQGP GLNSVAPVFR EVGLMLKK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-40161191104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1167191RKRSNSSCSANDNPGDAEVESRRLK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6768200.0EF676820.1 Picea sitchensis clone WS02753_L15 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LM220.0B8LM22_PICSI; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.11e-59myb domain protein 77